Protein Info for CSW01_01675 in Vibrio cholerae E7946 ATCC 55056

Annotation: transcription termination/antitermination protein NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF02357: NusG" amino acids 7 to 111 (105 residues), 104.1 bits, see alignment E=4.7e-34 TIGR00922: transcription termination/antitermination factor NusG" amino acids 9 to 181 (173 residues), 235.7 bits, see alignment E=1.4e-74 PF00467: KOW" amino acids 131 to 159 (29 residues), 30.7 bits, see alignment 2e-11

Best Hits

Swiss-Prot: 100% identical to NUSG_VIBCH: Transcription termination/antitermination protein NusG (nusG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 96% identity to vsp:VS_2970)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>CSW01_01675 transcription termination/antitermination protein NusG (Vibrio cholerae E7946 ATCC 55056)
MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKMHGMEELFGEVLVPTEEVVEMRAGQRRKS
ERKFFPGYVLVQMIMNDESWHLVRSVPRVMGFIGGTSDRPAPITDKEADAILNRLEKASE
APRPKTMFEAGEVVRVNDGPFADFNGTVEEVDYEKSRLKVSVSIFGRATPVELEFGQVEK
LD