Protein Info for CSW01_01670 in Vibrio cholerae E7946 ATCC 55056

Annotation: protein translocase subunit SecE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details TIGR00964: preprotein translocase, SecE subunit" amino acids 72 to 122 (51 residues), 59.1 bits, see alignment E=1.5e-20 PF00584: SecE" amino acids 72 to 122 (51 residues), 68.7 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 100% identical to SECE_VIBCH: Protein translocase subunit SecE (secE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 100% identity to vcm:VCM66_0306)

MetaCyc: 59% identical to Sec translocon subunit SecE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>CSW01_01670 protein translocase subunit SecE (Vibrio cholerae E7946 ATCC 55056)
MKANNAEAPDSSNAADTLKWVATFVLLVAAVVGNYLYGELSVVARAAGVIVLIAAALGVA
ATTTKGKEAIVFARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLV
AFATGV