Protein Info for CSW01_01635 in Vibrio cholerae E7946 ATCC 55056

Annotation: bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 140 to 163 (24 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details PF08279: HTH_11" amino acids 8 to 59 (52 residues), 40.7 bits, see alignment 2.7e-14 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 80 to 317 (238 residues), 226.2 bits, see alignment E=4.4e-71 PF03099: BPL_LplA_LipB" amino acids 85 to 207 (123 residues), 88.1 bits, see alignment E=7.5e-29 PF02237: BPL_C" amino acids 271 to 317 (47 residues), 51.7 bits, see alignment 1e-17

Best Hits

Swiss-Prot: 56% identical to BIRA_SALTY: Bifunctional ligase/repressor BirA (birA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 100% identity to vcj:VCD_001305)

MetaCyc: 55% identical to DNA-binding transcriptional repressor/biotin-[acetyl-CoA-carboxylase] ligase BirA (Escherichia coli K-12 substr. MG1655)
Biotin--[acetyl-CoA-carboxylase] ligase. [EC: 6.3.4.15]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>CSW01_01635 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA (Vibrio cholerae E7946 ATCC 55056)
MKEHSAKLAILKQLADGDFHSGEVLGAQLGISRAAISKHIQGIRDWGVDVFRVQGKGYQL
AQAMTLLDQSVIQSQVNNPVELHPIIGSTNQYLLDHVETLVSGTVCLAEYQASGRGRRGR
HWVSPFGANLYLSIYWRLDAGMAAAMGLSLVVGVAIVEALEAMGVDGVKLKWPNDLYYQD
KKLAGILVEMSGQAGAAAHLVIGMGINLAMRDNEGNIDQPWISLAEVTGQSRIDRNALAI
NLIAALDRTLRQYEISGMQNFVERWNRWDNFIGRPVKLLMGANEVRGIERGIDEHGGVLL
ETEEGLKSFIGGEISLRKND