Protein Info for CSW01_01575 in Vibrio cholerae E7946 ATCC 55056

Annotation: 4-hydroxy-3-polyprenylbenzoate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 6 to 455 (450 residues), 540.5 bits, E=1.4e-166
• PF20695: UbiD_N
  • amino acids 10 to 87 (78 residues), 96.1 bits, E=1.6e-31
• PF01977: UbiD
  • amino acids 123 to 322 (200 residues), 269.6 bits, E=2e-84
• PF20696: UbiD_C
  • amino acids 328 to 452 (125 residues), 138.4 bits, E=2.1e-44
  • amino acids 482 to 567 (86 residues), 66.4 bits, E=3.9e-22

Best Hits

Swiss-Prot: 100% identical to UBID_VIBCH: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 100% identity to vcj:VCD_001312)

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Protein Sequence (613 amino acids)

>CSW01_01575 4-hydroxy-3-polyprenylbenzoate decarboxylase (Vibrio cholerae E7946 ATCC 55056)
MNFKDLRDFLDYLEQRGELKRITHPIDPHYEMTEISDRTLRAKGPALLFENPLGYDFPVL
TNLFGTPERVAMGMGRQQVQELRDVGQWLAYLKEPEPPRGLKELIEKLPVFKQVLNMPVK
RLRRAPCQEIVWQGDAVDLDKIPVMSCWPDDVAPLLTWGLTITRGPHKKRQNLGIYRQQK
IARNKVIMRWLAHRGGALDLRDWMEKHPGEPFPVSVAFGADPATILGAVTPVPDTLSEYA
FAGLLRGSRTEVVKSISNDLEVPASAEIVLEGYIDPNEFADEGPYGDHTGYYNEVERHHV
FTVTHVTMRNKPIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIADFYLPPEGCSY
RMAIVTLKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVCDEQVNARDWPQVIAAMVNHMSP
LRDTLFIEHTPIDSLDFASPVVGLGSKIGLDATAKWPAELAVSNSDQSDKTTELSLEALK
ACLSDEADVLDVALPEAANDKLVLLLINKQEAGQAQQLLQRVVDKLNGDSPLKFVILCDD
DVNIHDWNDVIWAMTTRMDPARDSLRIVGQDLICFDATNKLPDEVEREWGTPIRKDPKLV
AKIDSLWDELGIV