Protein Info for CSW01_01510 in Vibrio cholerae E7946 ATCC 55056

Annotation: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 1 to 153 (153 residues), 207.2 bits, E=9.5e-66
• PF00364: Biotin_lipoyl
  • amino acids 79 to 152 (74 residues), 87.1 bits, E=5.7e-29

Best Hits

Swiss-Prot: 73% identical to BCCP_SHIFL: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Shigella flexneri

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 100% identity to vco:VC0395_A2689)

MetaCyc: 73% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (5/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (5/18 steps found)

Protein Sequence (153 amino acids)

>CSW01_01510 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit (Vibrio cholerae E7946 ATCC 55056)
MDIRKIKKLIELVEESGIAELEISEGEESVRISRYGQPAPAPQVHYAAAPAPVAAPAPVA
QAAAVAEAPAAAKVPAGHKVLSPMVGTFYRSPSPDAKAFIEVGQSVSVGDTLCIVEAMKM
MNQIEADKSGVVTAILVEDGQTVEFDQPLVVIE