Protein Info for CSW01_01475 in Vibrio cholerae E7946 ATCC 55056

Annotation: gluconate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF13671: AAA_33" amino acids 6 to 135 (130 residues), 29.4 bits, see alignment E=1.3e-10 PF13238: AAA_18" amino acids 6 to 126 (121 residues), 36 bits, see alignment E=1.4e-12 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 6 to 164 (159 residues), 212 bits, see alignment E=2.2e-67 PF01202: SKI" amino acids 13 to 125 (113 residues), 41.9 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 47% identical to GNTK_ECOLI: Thermoresistant gluconokinase (gntK) from Escherichia coli (strain K12)

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 99% identity to vcm:VCM66_0272)

MetaCyc: 47% identical to D-gluconate kinase, thermostable (Escherichia coli K-12 substr. MG1655)
Gluconokinase. [EC: 2.7.1.12]

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>CSW01_01475 gluconate kinase (Vibrio cholerae E7946 ATCC 55056)
MAGSSIIVMGVCACGKSTIGELLAKQTGRKFIDGDDLHPRANIQKMASGQPLNDEDRKPW
LERIRDAAYSLESKNEHGVIVCSALKKQYRDQIREGNQNVTFLFLDGSKELIMERMRARQ
GHFMKENMVNSQFETLERPDGEPQTLIIPIDCSVQEVVSCAIQALQEQEGL