Protein Info for CSW01_01465 in Vibrio cholerae E7946 ATCC 55056

Annotation: ketohydroxyglutarate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01081: Aldolase
  • amino acids 3 to 195 (193 residues), 250.3 bits, E=5.4e-79
• TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
  • amino acids 3 to 200 (198 residues), 286.8 bits, E=3.5e-90

Best Hits

Swiss-Prot: 54% identical to ALKH_HAEIN: Putative KHG/KDPG aldolase (eda) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to vco:VC0395_A2663)

MetaCyc: 45% identical to 2-dehydro-3-deoxy-D-gluconate-6-phosphate aldolase (Dickeya dadantii 3937)
2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.2.14, 4.1.2.55]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• Entner-Doudoroff pathway I (8/9 steps found)
• Entner-Doudoroff shunt (2/2 steps found)
• trans-4-hydroxy-L-proline degradation I (3/5 steps found)
• D-glucosaminate degradation (1/3 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (5/9 steps found)
• D-fructuronate degradation (1/4 steps found)
• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (1/5 steps found)
• D-galacturonate degradation I (1/5 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (2/7 steps found)
• superpathway of β-D-glucuronosides degradation (2/7 steps found)
• superpathway of hexuronide and hexuronate degradation (2/10 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (6/31 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glyoxylate and dicarboxylate metabolism
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.2.55 or 4.1.3.16

Protein Sequence (201 amino acids)

>CSW01_01465 ketohydroxyglutarate aldolase (Vibrio cholerae E7946 ATCC 55056)
MTIEQRLRAIKIVPVIAINDVAHALPLAKVLVENGLPCAEVTFRTAAAAESIRIMRKAYP
DLLIGAGTVLTTAQVDEAIAAGADFIVSPGLNPTTVKYCQQRNIAIIPGVNNPSLVEQAM
EMGLRTLKFFPAEPSGGIAMLKALSAVYPVSFMPTGGINPNNAQEYLALKSVVACGGTWM
VPTDLMDKGDWDTLAELVRNV