Protein Info for CSW01_01395 in Vibrio cholerae E7946 ATCC 55056

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00480: ROK
  • amino acids 34 to 326 (293 residues), 239.5 bits, E=5.8e-75
• PF02685: Glucokinase
  • amino acids 37 to 232 (196 residues), 31.7 bits, E=9e-12

Best Hits

Swiss-Prot: 41% identical to NAGK_HAEIN: N-acetyl-D-glucosamine kinase (nagK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 100% identity to vco:VC0395_A2648)

Predicted SEED Role

"ROK family Glucokinase with ambiguous substrate specificity"

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (15/19 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• heterolactic fermentation (13/18 steps found)
• D-sorbitol degradation I (2/3 steps found)
• sucrose degradation I (sucrose phosphotransferase) (2/3 steps found)
• mannitol cycle (3/5 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.4

Use Curated BLAST to search for 2.7.1.4

Protein Sequence (326 amino acids)

>CSW01_01395 transcriptional regulator (Vibrio cholerae E7946 ATCC 55056)
MQQDVSREHTINNGSSMADHDEHPIEQKEFYMLIGLDIGGTKIEICVLDKQGSMLYRQRI
ATPDNYSQFVDCVCSLIVDAEQATQPVDSIGIGLPGAVSPVTGLIKNANCTFLNGQDLSS
DLQYRLGREVKLANDANCFALSEAIDGAGKESMVVFGAILGTGCGGSIVVNRQVLVGPNA
ICGEWGHNPLPGYHLEQDGAARYCYCGRQNCIERFISGSGFQDSYQALTGECITASEIMK
RYKQQEPEAIHCYTQLIDHMARSFAGLVNVLDPDIIVLGGGLSNIDELYRDLPTATARHV
FSDSAQVHFAKAVFGDSSGIRGAAWL