Protein Info for CSW01_01345 in Vibrio cholerae E7946 ATCC 55056

Annotation: glycosyl transferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF13439: Glyco_transf_4" amino acids 16 to 171 (156 residues), 58.6 bits, see alignment E=2.1e-19 PF13579: Glyco_trans_4_4" amino acids 16 to 167 (152 residues), 38.4 bits, see alignment E=4e-13 PF00534: Glycos_transf_1" amino acids 180 to 344 (165 residues), 132.6 bits, see alignment E=2.7e-42 PF13692: Glyco_trans_1_4" amino acids 194 to 327 (134 residues), 80 bits, see alignment E=5.5e-26

Best Hits

KEGG orthology group: K12995, rhamnosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to vch:VC0259)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>CSW01_01345 glycosyl transferase family 1 (Vibrio cholerae E7946 ATCC 55056)
MKVLHVYRTCYPETKGGVEQVIRFIASGTKPLGIETKILTLSDNQTSSYYCEGTEIISVK
KSIEISSNGFSWKLIRQFKKLSKWADIIHYHYPWPTGDFLSLFGSSNPSIVTYHSDIIRQ
KCLKKLYQPLESHFLNQANILVATSPQYAHTSENLLRHKNKVKIIPLAVDENTYPIPSND
NINKWREKVGEGFFLFVGVLRYYKGLDFLLEAAKINQLPVIIAGDGPERVKLESYIAKHN
LENVKLVGFISEEDKVILHLLSKAFVFPSHLRSEAFGISLIEAQMYCKAIISSDIGTGSS
YVNINGETGLVVPPADSQSFSDAMLKIEHDTKLCEKLGINARKRFEQEFTAHRYAQSYTK
LYSELFGNVC