Protein Info for CSW01_01270 in Vibrio cholerae E7946 ATCC 55056

Annotation: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 3 to 465 (463 residues), 741.2 bits, see alignment E=2.3e-227 PF00483: NTP_transferase" amino acids 4 to 285 (282 residues), 209.4 bits, see alignment E=1.6e-65 PF12804: NTP_transf_3" amino acids 5 to 134 (130 residues), 32.6 bits, see alignment E=2.2e-11 PF22640: ManC_GMP_beta-helix" amino acids 297 to 346 (50 residues), 61.9 bits, see alignment 1.1e-20 PF01050: MannoseP_isomer" amino acids 350 to 464 (115 residues), 179.8 bits, see alignment E=4.3e-57 PF07883: Cupin_2" amino acids 380 to 448 (69 residues), 41.5 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 100% identical to RFBA_VIBCH: Putative mannose-1-phosphate guanylyltransferase (rfbA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] (inferred from 100% identity to vcj:VCD_001376)

MetaCyc: 62% identical to mannose-1-phosphate guanylyltransferase (Escherichia coli K-12 substr. MG1655)
Mannose-1-phosphate guanylyltransferase. [EC: 2.7.7.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.13 or 2.7.7.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>CSW01_01270 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (Vibrio cholerae E7946 ATCC 55056)
MFIPVIMAGGSGSRLWPLSRSAFPKQFLSLDSSSQHTMLQATIERLQGLPIAEPIVISNE
DHRFIVAEQIRRYGKKSRIILEPAGRNTAPAIALAAFTAIEQEDDPVLLVLAADHFVKNK
SAFQAAISQAAQQAEAGKLATFGIVPTTPETGYGYIHRGEEVTQGTYEINSFVEKPQLNI
AEQYLASGEYYWNSGCFMFKASVFLNELKQHSPEIYRQCELAMQGLSHDYDFIRVGVEEF
LKCPDDSIDYAVMEHTKLGVVVSMDAGWSDVGSWSALWEVSDKDADGNVCQGDAILSGTS
NCYIYAPNKLVAAVGLKDIVVVETKDAVLVADKNQVQEVKKIVEHLKAENRAEYREHRER
YRPWGKSDAIDKGERYKVNRITVEPGKKQSLQMHYHRAEHWVVVSGTAKVTCEGNVKVIT
ENQSLYIPIGTNHMIENPGKIPLELIEIQSGSYLNEDDVVRFEDK