Protein Info for CSW01_01260 in Vibrio cholerae E7946 ATCC 55056

Annotation: polysaccharide deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 13 to 154 (142 residues), 38.1 bits, see alignment E=4.1e-13 PF13439: Glyco_transf_4" amino acids 13 to 158 (146 residues), 83.8 bits, see alignment E=3e-27 PF13477: Glyco_trans_4_2" amino acids 14 to 110 (97 residues), 27.5 bits, see alignment E=6.6e-10 PF01522: Polysacc_deac_1" amino acids 405 to 542 (138 residues), 106.5 bits, see alignment E=1.9e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2619)

Predicted SEED Role

"Polysaccharide deacetylase" in subsystem Polysaccharide deacetylases or Predicted carbohydrate hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>CSW01_01260 polysaccharide deacetylase (Vibrio cholerae E7946 ATCC 55056)
MNILMALSQLEVTGAEVYATSVGNELTRRGHQVFYVSDTLTKAHDGLFFKLRFNKRSIPR
RFWHVAYLVYLIKKHQIQLVHAHSRASSWSCHIACRLTNTPMVTTVHGRQPVHVSRKKFH
AMGDKALPVCEAIREQLIKDLNVPESQLHVSRNGIETSIFKRSAAPNNPKPVISIIGRLS
GPKGELCYRLLTECLDLDRYQVQVITGTPLTERFSALQDKVSFPGYSANVEQIMAQSDLV
IGAGRVAMEALLCGRPTLAIGEASCVGIIELDNLNQAMATNFGDIGPHDLAIDFQQIPAL
IEQGLSQPHCTQEITEQIKLNYDLQVIVNELENLYQTFYVNKLQREVPIIMYHRFIRDDS
EKGVHGTYLHVQQLEKHFQLLKKMGFETLTFKDLSEKGFIHRLQPGKRFIIITVDDGYRD
NYDLLLPLLKKYQFKAVVYVVTGENFNRWDVEVSDNPEKVVPLMSPEQVKALHDSGLVEI
GGHTMTHPFLSKLSESEQREEILRNKLELEALIGEPLTSFAYPYGDHDATSKQLAQDLGY
PFAVATNSGPLLMHQDPYQIRRIAIFPRTDTFGLWRKVKGNYLFRKMNKK