Protein Info for CSW01_01110 in Vibrio cholerae E7946 ATCC 55056

Annotation: YicC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 TIGR00255: TIGR00255 family protein" amino acids 1 to 288 (288 residues), 390.2 bits, see alignment E=3.7e-121 PF03755: YicC_N" amino acids 2 to 154 (153 residues), 146.7 bits, see alignment E=7.9e-47 PF08340: DUF1732" amino acids 204 to 288 (85 residues), 115.9 bits, see alignment E=6.4e-38

Best Hits

Swiss-Prot: 65% identical to YICC_ECOLI: UPF0701 protein YicC (yicC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2588)

Predicted SEED Role

"Protein YicC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>CSW01_01110 YicC family protein (Vibrio cholerae E7946 ATCC 55056)
MIYSMTAYARKEVKGDWGSAVWEIRSVNQRYLETYFRLPEQFRGLEPLLRERFRQRLSRG
KIECHLRFEANPAAQSHLTINEGLAQQVINAANQIMHMTGELSRINPFQVMQWPGVMETP
EQDMDAINQALLSAFDEGVDEFIAARGREGDNMKALIEQRLQAISAEVVKVRARMPEILE
WQRERLFSKFEEAKIELDASRVEQELILLAQKSDVAEELDRLDSHVKEAREVLKKGGSCG
RKLDFMMQEFNRESNTLASKSISTDITASGVELKVLIEQMREQIQNIE