Protein Info for CSW01_00760 in Vibrio cholerae E7946 ATCC 55056

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00140: Sigma70_r1_2" amino acids 14 to 40 (27 residues), 32.6 bits, see alignment (E = 9.4e-12) TIGR02392: alternative sigma factor RpoH" amino acids 15 to 283 (269 residues), 419.2 bits, see alignment E=8.2e-130 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 48 to 282 (235 residues), 116.2 bits, see alignment E=1.2e-37 PF04542: Sigma70_r2" amino acids 53 to 122 (70 residues), 65.9 bits, see alignment E=3.3e-22 PF04545: Sigma70_r4" amino acids 229 to 281 (53 residues), 57.6 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 100% identical to RPOH_VIBCH: RNA polymerase sigma factor RpoH (rpoH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to vcj:VCD_001607)

MetaCyc: 71% identical to RNA polymerase sigma factor RpoH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>CSW01_00760 RNA polymerase sigma factor RpoH (Vibrio cholerae E7946 ATCC 55056)
MTNQAYPMALVSQDSLDSYIRSVNGYPMLSADEERELAERLHYKGDIDAAKGLILSHLRF
VVHVARGYSGYGLPMADLVQEGNIGLMKAVKRFNPEMGVRLVSFAVHWIKAEIHEYVLRN
WRIVKIATTKAQRKLFFNLRKSKKRLGWFNNGEVETVARELGVEPAEVREMESRLAAQDA
AFEMSAEDDENGMAYTAPVLYLEDKHSDLADNLEAENWEAHTTQRLSMALASLDERSQHI
VRARWLDDDNKTTLQDLAEMYGVSAERIRQLEKNAMRKLKEAVGEF