Protein Info for CSW01_00730 in Vibrio cholerae E7946 ATCC 55056

Annotation: lysoplasmalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF07947: YhhN" amino acids 28 to 207 (180 residues), 128.5 bits, see alignment E=1.2e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2377)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>CSW01_00730 lysoplasmalogenase (Vibrio cholerae E7946 ATCC 55056)
MSMLSWISVVLSGFISISAYENQKLKQAIFFRIFSLLLLTIIVWEQHSHATPEVIFISLG
LAVSMFAHGLRLNHRYHKASFVLFLVAQLLFSKAFWVQLSGSMVWWLPALLVAASIVAFF
LLLPQIDTLIFPVTIMGLMLVQMTWAAGELWLQEATVASGAGFLGCLVYILSATLLAIHD
YRRPLPWGHTLISSSYLIAQALISASIVF