Protein Info for CSW01_00695 in Vibrio cholerae E7946 ATCC 55056

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF00563: EAL" amino acids 72 to 194 (123 residues), 48.5 bits, see alignment E=7.6e-17 PF08668: HDOD" amino acids 208 to 324 (117 residues), 53.3 bits, see alignment E=2.7e-18

Best Hits

Swiss-Prot: 100% identical to CDGJ_VIBCH: Cyclic di-GMP phosphodiesterase CdgJ (cdgJ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07181, putative signal transduction protein containing EAL and modified HD-GYP domains (inferred from 100% identity to vco:VC0395_A2383)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>CSW01_00695 EAL domain-containing protein (Vibrio cholerae E7946 ATCC 55056)
MYTTYVARQPILNAKRHTLGYELLFRDGEKNAFPEYMDADRATYRLIVENFLSLGTNPRI
ARSRCFINFPHKSLIRRLPLTLPREQIVVEILETCQPTDDLFEAVQELSQRGYLLALDDF
VYSPAWERFLPYVQIVKIDIMAMGLDKACEFVRGRLAQGSRRRFLAERVETEDEFHQARH
AGFTFFQGYFFSKPEIIKQRYVSPEHVIAMQLFREVCQPEVDYVRVERLVAQDIALSYKL
LRFVNTMSDRISVSISSFRQALVYLGQDKLRIFVSLAVASYISSKKPKELYNLSLQRAQF
CQLMATHTHFKAHREQAFLIGMFSVLDALLDTSIEQLVEQLPLADDVKLALREREGPLGT
LLDLEECFEKADWQGVEQHCLELGFDLEDVRQELIEAQRWSQDINRLI