Protein Info for CSW01_00680 in Vibrio cholerae E7946 ATCC 55056

Annotation: Cof-type HAD-IIB family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF05116: S6PP" amino acids 11 to 84 (74 residues), 30.4 bits, see alignment E=6.3e-11 amino acids 156 to 249 (94 residues), 35.3 bits, see alignment E=1.9e-12 TIGR01484: HAD hydrolase, family IIB" amino acids 12 to 241 (230 residues), 106 bits, see alignment E=2.9e-34 TIGR00099: Cof-like hydrolase" amino acids 12 to 270 (259 residues), 199.3 bits, see alignment E=8.2e-63 PF08282: Hydrolase_3" amino acids 13 to 270 (258 residues), 213.2 bits, see alignment E=1.1e-66

Best Hits

Swiss-Prot: 50% identical to YIGL_ECOLI: Pyridoxal phosphate phosphatase YigL (yigL) from Escherichia coli (strain K12)

KEGG orthology group: K07024, (no description) (inferred from 100% identity to vco:VC0395_A2386)

MetaCyc: 50% identical to phosphosugar phosphatase YigL (Escherichia coli K-12 substr. MG1655)
Pyridoxal phosphatase. [EC: 3.1.3.74]; Sugar-phosphatase. [EC: 3.1.3.74, 3.1.3.23]

Predicted SEED Role

"Cof protein, HD superfamily hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.23 or 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>CSW01_00680 Cof-type HAD-IIB family hydrolase (Vibrio cholerae E7946 ATCC 55056)
MTTSAHKHPYKIVASDLDGTLLAPNHQLSEFSKQTLKQLHDKGFTFIFATGRHHIDVAGI
REIAGIPAYMITSNGARVHDQNDQLMYSKNVPQDLVQAIIDVVKHDKQLFVHLYRNDEWM
LNKEDEILRDFHEDSGFTYRVFDVNNAPTDGIAKIFFTQEDQDHEHLVQYETLLNQRFGD
KLNVAFSTPWCLEVMCAGVSKGDALQAVAESLHLGLENCIAFGDGMNDVEMLSMAGKGLV
MGTAHEKVFNALPDNEVIGSNADDAVAHYLHQHLF