Protein Info for CSW01_00635 in Vibrio cholerae E7946 ATCC 55056

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 5 to 412 (408 residues), 564.5 bits, E=5.3e-174
• PF00278: Orn_DAP_Arg_deC
  • amino acids 31 to 370 (340 residues), 95.8 bits, E=2.3e-31
• PF02784: Orn_Arg_deC_N
  • amino acids 36 to 282 (247 residues), 243.5 bits, E=3.4e-76
• PF01168: Ala_racemase_N
  • amino acids 37 to 235 (199 residues), 29.1 bits, E=1.2e-10

Best Hits

Swiss-Prot: 100% identical to DCDA_VIBCH: Diaminopimelate decarboxylase (lysA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to vch:VC0125)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Protein Sequence (417 amino acids)

>CSW01_00635 diaminopimelate decarboxylase (Vibrio cholerae E7946 ATCC 55056)
MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV
KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI
KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA
QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG
LGVVYRDELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHK
NFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTYDLVGPVCETSDFLGKDRDLVLQE
GDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVLPE