Protein Info for CSW01_00455 in Vibrio cholerae E7946 ATCC 55056

Annotation: ubiquinone biosynthesis protein UbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 499 to 517 (19 residues), see Phobius details amino acids 523 to 542 (20 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 6 to 445 (440 residues), 589.9 bits, see alignment E=1.2e-181 PF03109: ABC1" amino acids 93 to 342 (250 residues), 263.8 bits, see alignment E=6e-83

Best Hits

Swiss-Prot: 100% identical to UBIB_VIBCM: Probable protein kinase UbiB (ubiB) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 100% identity to vcj:VCD_001552)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>CSW01_00455 ubiquinone biosynthesis protein UbiB (Vibrio cholerae E7946 ATCC 55056)
MKPAELKRLYRIVKVQLEYGLDELLPEHHLTRAPLLARKSLFWLRNQHADKALGDRLRLA
LQELGPVWIKFGQMMSTRRDLFPPHIADPLAMLQDKVAPFDGLQAKQLIEEELGAPLETW
FDDFDIKPLASASIAQVHTAKLKSNGRDVVLKVIRPDIRPQIDADIKLMYRVARIVAKAL
PEARRLKPVEVVREYEKTLLDELDLRREAANAIQLRRNFENSEELYVPEVLTDFCNETVM
VSERIYGIQVSDLAGLHANGTNMKLLAERGVSVFFTQVFRDSFFHADMHPGNVFVNPNHP
ENPQWIGLDCGIVGTLNSEDKRYLAENFLAFFNRDYRRVAQLHVDSGWVPLDTNVDEFEV
AIRMVCEPIFAKPLCEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP
QLDLWQTAKPFLEKWMANQVGPQAFLHALKERAPLWFEKMPELPELLYDSLKQGRNLNQR
LDNLYQGYRQSKRQQGTGKFLFGVGATLVVCSAIWISNQLEPLAIGSATIGVLCWLLSWR
AYRQ