Protein Info for CSW01_00270 in Vibrio cholerae E7946 ATCC 55056

Annotation: threonylcarbamoyl-AMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 6 to 188 (183 residues), 135.9 bits, see alignment E=5.3e-44 PF01300: Sua5_yciO_yrdC" amino acids 13 to 188 (176 residues), 173.3 bits, see alignment E=1.8e-55

Best Hits

Swiss-Prot: 100% identical to TSAC_VIBCH: Threonylcarbamoyl-AMP synthase (tsaC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07566, putative translation factor (inferred from 100% identity to vcj:VCD_001522)

MetaCyc: 59% identical to L-threonylcarbamoyladenylate synthase (Escherichia coli K-12 substr. MG1655)
RXN-14569 [EC: 2.7.7.87]

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>CSW01_00270 threonylcarbamoyl-AMP synthase (Vibrio cholerae E7946 ATCC 55056)
MALVENLQQAVDALRKGCVIAYPTEGVFGLGCDPDNQTAMLRLLAIKQRPVEKGVILIAA
SYAQLRPYVDETQLTAEQLTQVLASWPAPLTWVMPASGDTPSWVRGQFDTVAVRVSDHPV
VQKLCLAFGKPLTSTSANLSGQPACVTQQEVMVQLGNQIAVVVEGKTSGRHGPSEIRDAR
SLQVLRQG