Protein Info for CSW01_00180 in Vibrio cholerae E7946 ATCC 55056

Annotation: cytochrome c oxidase accessory protein CcoG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 50 to 67 (18 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 44 to 472 (429 residues), 582.6 bits, see alignment E=2.8e-179 PF12801: Fer4_5" amino acids 98 to 128 (31 residues), 30.6 bits, see alignment (E = 1.3e-10) PF13746: Fer4_18" amino acids 223 to 327 (105 residues), 137.6 bits, see alignment E=1.1e-43 PF11614: FixG_C" amino acids 358 to 471 (114 residues), 107.6 bits, see alignment E=2.4e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2483)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>CSW01_00180 cytochrome c oxidase accessory protein CcoG (Vibrio cholerae E7946 ATCC 55056)
MSQDKIDVKDVTPKVFNPKTHKGQGGDRFNPSNRIYVRESKGTYQKLRRYGGWFLLLLFG
LVPWISYGDRQAILLDIGNQQFNFFGTTLYPQDLTLLALLFMIAAFGLFFITTFLGRVWC
GYLCPQTVWTFMYIWFEEKLEGNANKRRKQDNSPMTAELVARKTLKHIAWLAIALVTGFT
FVGYFVPIRALVIDFFTLSAAFWPVFWVLFFALCTYGNAGWMRSIMCIHMCPYARFQSAM
FDKDTFIVGYDVARGEQRGPRSRKADPKALGLGDCIDCDLCVQVCPTGIDIRDGLQYECI
NCGACIDACDNTMERMGYAKGLISYTTEHRLSGKHTKVMRPKLLGYGAVFLVMIGLFFAQ
VAAVDPAGLTVLRDRTQLFRTNSSGEIENTYNLKVINKTQQPQTYQLSVKGLDPVSWYGK
QSVVVQPGEVLNLPMTLGAKPENLSSAVTTIQFILHDESHQFTLEVESRFIQKL