Protein Info for CSW01_00155 in Vibrio cholerae E7946 ATCC 55056

Annotation: acetolactate synthase 2 catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 TIGR00118: acetolactate synthase, large subunit, biosynthetic type" amino acids 1 to 546 (546 residues), 692.2 bits, see alignment E=2.4e-212 PF02776: TPP_enzyme_N" amino acids 1 to 116 (116 residues), 142.3 bits, see alignment E=9.2e-46 PF00205: TPP_enzyme_M" amino acids 188 to 322 (135 residues), 148.6 bits, see alignment E=1.4e-47 PF02775: TPP_enzyme_C" amino acids 375 to 523 (149 residues), 173.5 bits, see alignment E=4e-55

Best Hits

Swiss-Prot: 47% identical to ILVB_CORGL: Acetolactate synthase large subunit (ilvB) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 100% identity to vcj:VCD_001499)

Predicted SEED Role

"Acetolactate synthase large subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>CSW01_00155 acetolactate synthase 2 catalytic subunit (Vibrio cholerae E7946 ATCC 55056)
MTGAQLVVAALKQQGIKTVFGYPGGAIMPIYDALYDGGVEHILCRHEQGAAMAAIGMARS
TQKVAVCMATSGPGATNLVTGLADAFLDSVPLVAITGQVASSHIGTDAFQEMDVIGMSLS
CTKHSYLVTDINELAPTLAEAFEVAQTGRPGPVLVDIAKDVQLGKAPVSALPSFTPPAMP
HVDATHLANAQALLAQSKRPVLYVGGGVQLANATDTVREFLRLNPMPSVSTLKGLGTIER
HDPHYLGMLGMHGTKAANLIVQECDLLIAVGARFDDRVTGKLDTFAPHAKVIHVDIDAAE
FNKLRHAHAALRGDINLILPQLELSHDISPWVHHSESLRSGFKWRYDHPGDNIFAPLLLK
QLSDMMPDSSIVSTDVGQHQMWAAQHIQPRAPQNFISSAGLGTMGFGLPAAMGAAVARPD
DQSILISGDGSFMMNVQELGTLKRRQIPVKMVLLDNQRLGMVRQWQSLFFDGRHSETILD
DNPDFVMLAKAFNIPGKTISRKEEVEPALREMLASKTAYLLHVLIDEEENVWPLVPPGAS
NTDMLENT