Protein Info for CSW01_00055 in Vibrio cholerae E7946 ATCC 55056

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 68.5 bits, see alignment E=1e-22 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 465 (460 residues), 619.7 bits, see alignment E=1.7e-190 PF00308: Bac_DnaA" amino acids 133 to 292 (160 residues), 245.6 bits, see alignment E=8.5e-77 PF01695: IstB_IS21" amino acids 168 to 270 (103 residues), 30 bits, see alignment E=1.1e-10 PF00004: AAA" amino acids 169 to 270 (102 residues), 27.6 bits, see alignment E=1.1e-09 PF22688: Hda_lid" amino acids 301 to 363 (63 residues), 29.8 bits, see alignment E=1.4e-10 PF08299: Bac_DnaA_C" amino acids 376 to 444 (69 residues), 113.1 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 100% identical to DNAA_VIBCH: Chromosomal replication initiator protein DnaA (dnaA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to vcm:VCM66_0012)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>CSW01_00055 chromosomal replication initiator protein DnaA (Vibrio cholerae E7946 ATCC 55056)
MSSSLWLQCLQRLQEELPAAEFSMWVRPLQAELNDNTLTLFAPNRFVLDWVRDKYLNNIN
RLLMEFSGNDVPNLRFEVGSRPVVAPKPAPVRTAADVAAESSAPAQLAQRKPIHKTWDDD
SAAADITHRSNVNPKHKFNNFVEGKSNQLGLAAARQVSDNPGAAYNPLFLYGGTGLGKTH
LLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFF
ANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELE
TRVAILMKKAEDHQIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVR
EALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQLAMALAKELTNH
SLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLIRTLSS