Protein Info for CCNA_03989 in Caulobacter crescentus NA1000

Annotation: MarR-family HTH transcriptional regulator / N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF12802: MarR_2" amino acids 40 to 96 (57 residues), 48.2 bits, see alignment E=4.7e-16 PF12840: HTH_20" amino acids 42 to 87 (46 residues), 27.4 bits, see alignment 1.3e-09 PF01047: MarR" amino acids 42 to 97 (56 residues), 46.1 bits, see alignment E=1.8e-15 PF13463: HTH_27" amino acids 45 to 106 (62 residues), 22.5 bits, see alignment E=5.6e-08 PF09339: HTH_IclR" amino acids 54 to 88 (35 residues), 22.9 bits, see alignment 3e-08 PF13412: HTH_24" amino acids 56 to 87 (32 residues), 23.4 bits, see alignment 1.8e-08 PF00583: Acetyltransf_1" amino acids 185 to 293 (109 residues), 43.2 bits, see alignment E=2.2e-14 PF13673: Acetyltransf_10" amino acids 204 to 308 (105 residues), 23.8 bits, see alignment E=1.9e-08 PF13508: Acetyltransf_7" amino acids 216 to 294 (79 residues), 39.7 bits, see alignment E=2.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_04004)

Predicted SEED Role

"Transcriptional regulator, MarR family / GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3J4B5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>CCNA_03989 MarR-family HTH transcriptional regulator / N-acyltransferase (Caulobacter crescentus NA1000)
MDVDLLAGLGVGFLGSRLKRLAERMQADAAEVARSLELPVQPAQMPLLMAIRMHEPISVG
ELAERLQLAQPTVTRALGPLERNGLVEARRAPGDQRTKRLVFTDKGRALMARIQTELLPR
IEPAAAQLLAGLSGDFMLGLSRVEARLTEQSLLSRADTAGRPLVWARDFSDDLAEAFYRI
NAEWIQEMFALEENDIALLSKPRELILDKGGVVLFAEAADLGVVGTCALMVSKDGWVELT
KMGVLKSARGLKAGEFLLAKTLERAKSLGMDKIYLLTNRKCEAAIHLYEKLGFVHDETIM
RKFGARYQRCDVAMSYRPR