Protein Info for CCNA_03892 in Caulobacter crescentus NA1000

Annotation: HD family metal-dependent phosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF12917: YfbR-like" amino acids 50 to 122 (73 residues), 27.8 bits, see alignment E=1.9e-10 PF01966: HD" amino acids 60 to 144 (85 residues), 26.2 bits, see alignment E=8.3e-10

Best Hits

Swiss-Prot: 61% identical to Y048_RHOCB: Uncharacterized protein RCAP_rcc00048 (RCAP_rcc00048) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K06952, (no description) (inferred from 100% identity to ccr:CC_1451)

Predicted SEED Role

"COG1896: Predicted hydrolases of HD superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3ICY6 at UniProt or InterPro

Protein Sequence (214 amino acids)

>CCNA_03892 HD family metal-dependent phosphohydrolase (Caulobacter crescentus NA1000)
MAKGLHRGGPPRAWQRMLSGRRLDLLDPSPMDIEIEDIAHGLARVARWNGQTVGDHGFSV
AQHSLVVEEIAAHIKPDLEPRWRLAALLHDASEYVIGDMISPFKAALGVSYKDFETRLED
AIHIRFGLPVKTPTPIKKLIKQADRACAFFEATQLAGFEHAESLAIFGAPPAGYELRITP
LAPFEAQARYVKRFHVLSRAAGYESAPGEAFETE