Protein Info for CCNA_03885 in Caulobacter crescentus NA1000

Annotation: Abi superfamily/CAAX amino terminal protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 34 to 50 (17 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details PF02517: Rce1-like" amino acids 113 to 200 (88 residues), 54.4 bits, see alignment E=6.5e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3IC28 at UniProt or InterPro

Protein Sequence (216 amino acids)

>CCNA_03885 Abi superfamily/CAAX amino terminal protease (Caulobacter crescentus NA1000)
MAMLGLALAAAYVLPLLLVAITYKQQGLSWLKPSMLWLFAAICVAIILLAQSPGDTVRAL
GLVSITARSLVIALAIVFALAAGSAVVLFVQRRLGLPLGDKATYTRIAEAPLSLRAFAVL
TAGVVEELLYRGIGIGVGDLLIGDAALAAVLSVIAFTAAHFRWQVAHLVQVAVAGAILSA
AFLLTRDLWACVIAHLLVDALGFIVVPALRKRVAKA