Protein Info for CCNA_03876 in Caulobacter crescentus NA1000

Annotation: transcription termination factor rho

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 TIGR00767: transcription termination factor Rho" amino acids 61 to 476 (416 residues), 681.4 bits, see alignment E=2.2e-209 PF07498: Rho_N" amino acids 64 to 105 (42 residues), 57.8 bits, see alignment 1.3e-19 PF07497: Rho_RNA_bind" amino acids 111 to 184 (74 residues), 109.2 bits, see alignment E=1e-35 PF00006: ATP-synt_ab" amino acids 219 to 422 (204 residues), 99.3 bits, see alignment E=3.8e-32

Best Hits

Swiss-Prot: 80% identical to RHO_RHOS4: Transcription termination factor Rho (rho) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K03628, transcription termination factor Rho (inferred from 100% identity to ccs:CCNA_03876)

Predicted SEED Role

"Transcription termination factor Rho" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CG88 at UniProt or InterPro

Protein Sequence (477 amino acids)

>CCNA_03876 transcription termination factor rho (Caulobacter crescentus NA1000)
MTEDTENQVPAADEATIENTVADTADITTEAAVEAGVEGEGEDEGSDIAAAVAALGLKSM
SLQELKEKSPADLLAFAETFEVENANSMRKQDMMFAILKTLAEEGVEISGSGTMEVLQDG
FGFLRSPEANYLPGPDDIYVSPSQIRKYGLRTGDSVEGAIRSPREGERYFALTSVTKINF
ESPDNVRHKVHFDNLTPLYPEERLNMELPDPTVKDRSGRVIDIVAPLGKGQRCLIVAPPR
VGKTVMLQNIAKSIETNHPECYLIVLLIDERPEEVTDMQRTVKGEVIASTFDEPATRHVQ
VAEMVIEKAKRLVEHKRDVVILLDSVTRLGRAYNTTVPSSGKVLTGGVDANALQRPKRFF
GAARNVEEGGSLSIIATALIDTGSRMDEVIFEEFKGTGNSEIVLDRKVADKRIFPAIDVL
KSGTRKEELITPRDQLQKTYVLRRILNPMGASDAIEFLLDKLRQSKTNGDFFQSMNT