Protein Info for CCNA_03854 in Caulobacter crescentus NA1000

Updated annotation (from data): phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR03188.
Original annotation: phosphoribosyl-ATP pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR03188: phosphoribosyl-ATP diphosphatase" amino acids 9 to 91 (83 residues), 93.9 bits, see alignment E=2.8e-31 PF01503: PRA-PH" amino acids 10 to 94 (85 residues), 74.5 bits, see alignment E=3.5e-25

Best Hits

Swiss-Prot: 100% identical to HIS2_CAUVC: Phosphoribosyl-ATP pyrophosphatase (hisE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 98% identity to cse:Cseg_4250)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GW16 at UniProt or InterPro

Protein Sequence (107 amino acids)

>CCNA_03854 phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (Caulobacter crescentus NA1000)
MSQRLTDVLQRLAATIEARKGGDPSVSYTAKLLNDPALAAKKLGEEAVETVIAAVAQGSD
ALAAESADLLYHWLALMAASGVSLDAVAEKLEAREGTSGIAEKASRA