Protein Info for CCNA_03830 in Caulobacter crescentus NA1000

Annotation: multidrug resistance protein A, efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF16576: HlyD_D23" amino acids 47 to 293 (247 residues), 58 bits, see alignment E=1.7e-19 PF13533: Biotin_lipoyl_2" amino acids 50 to 96 (47 residues), 51.4 bits, see alignment 1.4e-17 PF13437: HlyD_3" amino acids 216 to 296 (81 residues), 51.9 bits, see alignment E=2.3e-17

Best Hits

Swiss-Prot: 37% identical to EMRA_ACIBT: Colistin resistance protein EmrA (emrA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to ccr:CC_3714)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCL9 at UniProt or InterPro

Protein Sequence (369 amino acids)

>CCNA_03830 multidrug resistance protein A, efflux pump (Caulobacter crescentus NA1000)
MAMAASEKKKLVPLIVGGVAIAAVLVGGTLWFLDKQHFESTDNAFVQADTVQVSPQVSGY
VAEVLVADNQRVEPGQVLAKIDPSTFQARVDQAIANAAAADAAVRAIDDKNSLEQAVIAQ
RAAGVTSAQADASRAKADLDRYNALADQGWVSQQKVQTTRAAATQSAAGVASAQAALEAE
KRAAQSLGSAKAQAIAQAAAAHAAVEQAKLDLERTVIRAPVSGVVGARAVRPGQLVQPGV
ALMSVVPLGQAYVVANFKETQVARLRIGQPVEIKADAFGKEKIVGKVDSFAPATGQEFAL
IPIENAVGNFTKITQRLPVKIAVDRSQLGAALRPGLSVEIKVDVRDRSGPSFAEAAQVTP
QVARQGAAR