Protein Info for CCNA_03822 in Caulobacter crescentus NA1000

Annotation: formamidopyrimidine-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF01149: Fapy_DNA_glyco" amino acids 1 to 128 (128 residues), 122.5 bits, see alignment E=2.2e-39 TIGR00577: DNA-formamidopyrimidine glycosylase" amino acids 1 to 286 (286 residues), 266.4 bits, see alignment E=1.4e-83 PF06831: H2TH" amino acids 145 to 235 (91 residues), 82.9 bits, see alignment E=2e-27 PF06827: zf-FPG_IleRS" amino acids 257 to 286 (30 residues), 30.1 bits, see alignment (E = 5.2e-11)

Best Hits

Swiss-Prot: 100% identical to FPG_CAUVN: Formamidopyrimidine-DNA glycosylase (mutM) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K10563, formamidopyrimidine-DNA glycosylase [EC: 3.2.2.23 4.2.99.18] (inferred from 100% identity to ccr:CC_3707)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GVY4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>CCNA_03822 formamidopyrimidine-DNA glycosylase (Caulobacter crescentus NA1000)
MPELPEVETVRRGLEPVLSGARLSSVRANRPDLRFPLPDGFVQRLTGARILRLDRRAKYI
LAPLDRGDTLVMHLGMTGRFEIAAPEGTVRPGDFAREVTPDDKHAHVVFQTEDGATVTYF
DPRRFGFMDLIPTDRVSHHAWFAAMGPEPLGEGFDARTLEKAFANRKQGPKTLLLDQRTV
AGLGNIYVCEALHRSGISPFKPSGNIAKKRLTPLTAAIKDVLAEAVEVGGSTLKDFAAAD
GALGYFQHRFRVYDREGEPCPTPACKGVIAREVQAGRSTFFCPVCQV