Protein Info for CCNA_03782 in Caulobacter crescentus NA1000

Annotation: cytochrome c biogenesis ATP-binding export protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR01189: heme ABC exporter, ATP-binding protein CcmA" amino acids 8 to 196 (189 residues), 185.3 bits, see alignment E=5e-59 PF00005: ABC_tran" amino acids 22 to 161 (140 residues), 89.8 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 100% identical to CCMA_CAUVC: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 100% identity to ccr:CC_3668)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CED0 at UniProt or InterPro

Protein Sequence (204 amino acids)

>CCNA_03782 cytochrome c biogenesis ATP-binding export protein CcmA (Caulobacter crescentus NA1000)
MLRAVLIKDLAISRGERTLFSKLDLTLRAGEAATLVGRNGAGKTSLLRAVAGLLRPAAGS
TAFEDANGPVEADTARAEHLHMLGHQDGLKSSRTAWEELRFQTLWTGGNEDSARAAAQRF
DLRRLLDLEVRRLSAGQRRRLALARLAASPRSLWLLDEPMAPLDAGQRAAFGAVMAEHVA
GGGMILASVHDPLPIPARSVEVGA