Protein Info for CCNA_03774 in Caulobacter crescentus NA1000

Annotation: citrate lyase beta chain/citryl-CoA lyase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 11 to 225 (215 residues), 141.8 bits, E=2e-45

Best Hits

KEGG orthology group: K01644, citrate lyase subunit beta / citryl-CoA lyase [EC: 4.1.3.34 4.1.3.6] (inferred from 100% identity to ccs:CCNA_03774)

Predicted SEED Role

"L-malyl-CoA/beta-methylmalyl-CoA lyase (EC 4.1.3.-)" (EC 4.1.3.-)

MetaCyc Pathways

• citrate degradation (2/2 steps found)
• reductive TCA cycle II (6/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Citrate cycle (TCA cycle)
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.- or 4.1.3.34 or 4.1.3.6

Sequence Analysis Tools

See A0A0H3CCF9 at UniProt or InterPro

Protein Sequence (295 amino acids)

>CCNA_03774 citrate lyase beta chain/citryl-CoA lyase subunit (Caulobacter crescentus NA1000)
MTTAQANRPRRSALYMPASNAKAVEKARTLDADVIILDLEDAVAPEMKPAAREAAVAAVK
AGGFGPREVVIRVNGLDTPWGADDLAAAAEAGPDAVLVPKVNDAADVRLYDQHLSAAPTS
TRLWTMIETAKAAFHLWEIAEAAHSTRLSAWVMGVNDFAKEMRARQTPDRAPFLPLLTLS
VAAARAHGLMILDGVHNDIEDLAALEAVCVQGVDFGFDGKTLIHPKHLEICNRVFSPSPE
DVAWSHAVIAAFNAPENAGKGALRVDGKMAERLHLAQAERLVAVAQAISGRSAQG