Protein Info for CCNA_03756 in Caulobacter crescentus NA1000

Annotation: cation efflux family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 15 to 291 (277 residues), 185.7 bits, see alignment E=5.5e-59 PF01545: Cation_efflux" amino acids 19 to 212 (194 residues), 120.1 bits, see alignment E=1.1e-38 PF16916: ZT_dimer" amino acids 216 to 292 (77 residues), 72.6 bits, see alignment E=2.3e-24

Best Hits

Swiss-Prot: 39% identical to FIEF_CROS8: Cation-efflux pump FieF (fieF) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3641)

MetaCyc: 36% identical to Zn2+/Fe2+/Cd2+ exporter (Escherichia coli K-12 substr. MG1655)
RXN0-6; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CFU7 at UniProt or InterPro

Protein Sequence (309 amino acids)

>CCNA_03756 cation efflux family transporter (Caulobacter crescentus NA1000)
MSPSAASPEIRKATQRVAMLSVATAAILIVVKAIAWQASGSVAILASLSDSALDLVASLI
TVYAVRYAAEPPDAEHRFGHGKAEAFSSLMQGGLVFASGALVGREAINAWLHPQPVEHGL
AGVAVMAISIVLTLALITAQTRVVKASGSIAISGDRAHYAADLASNAVALVGVGAAAWLG
LPRVDAAAGLIVALWLIWGAVGVFREASHQLMDHELPDADRTKIVALVTADPNVLGVHQL
RTRASGPYIHIQMHADLAGDISLAEAHAIIVAAENRVLAAFPAADLIIHGDPRGLAEKHG
GLFSEVEHD