Protein Info for CCNA_03755 in Caulobacter crescentus NA1000

Annotation: bifunctional D-glycero-D-manno-heptose-7-phosphate 1-kinase/D-glycero-D-manno-heptose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 TIGR02198: bifunctional protein RfaE, domain I" amino acids 11 to 318 (308 residues), 392.6 bits, see alignment E=1.9e-121 PF00294: PfkB" amino acids 16 to 309 (294 residues), 131 bits, see alignment E=9e-42 TIGR02199: bifunctional protein RfaE, domain II" amino acids 341 to 482 (142 residues), 208.1 bits, see alignment E=7.2e-66 TIGR00125: cytidyltransferase-like domain" amino acids 352 to 417 (66 residues), 52.4 bits, see alignment E=7.2e-18 PF01467: CTP_transf_like" amino acids 354 to 449 (96 residues), 60 bits, see alignment E=4.5e-20

Best Hits

Swiss-Prot: 100% identical to HLDE_CAUVC: Bifunctional protein HldE (hldE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03272, D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC: 2.7.1.- 2.7.7.-] (inferred from 100% identity to ccs:CCNA_03755)

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-, 2.7.7.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CE81 at UniProt or InterPro

Protein Sequence (483 amino acids)

>CCNA_03755 bifunctional D-glycero-D-manno-heptose-7-phosphate 1-kinase/D-glycero-D-manno-heptose-1-phosphate adenylyltransferase (Caulobacter crescentus NA1000)
MDDALAHLPRAFAGKTVLVLGDVMLDRFIYGAVDRISPEAPVPVIAVEKETAMLGGAGNV
ARNVAALGAKAVLIGLVGRDDAGAALRGMIDAEAGLEAELVVDPARRTTEKVRYISGSHQ
MLRVDREDRSPGDGAALLAAFETRLASADVVVLSDYAKGVLTPAVVRGAIDAAKAAGKPV
IVDPKSRDFARYDGATLIKPNRKEAAEATGIVETSDAASEDAGAAILAMAPGLQAALITR
GGAGMTLAVRNQPPIHLPATAIEVFDVSGAGDTVAATLALAVAAGASLAQAAQLANLAGG
LVVAKLGTDVVTAAELTACASSAQGEPGEIKIADREQAQRIVEGWRARGLKVGFTNGCFD
LLHPGHVSLLSQAKAACDRLIVGLNTDASVSKLKGPTRPVQKEQGRATVLASLSSVDLVV
LFDEDTPLELIKAFRPDVLVKGADYTVETVVGSDVVLGYGGKVVLAELKQGQSTTNLIAR
MNS