Protein Info for CCNA_03746 in Caulobacter crescentus NA1000

Annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01892: acetylornithine deacetylase (ArgE)
  • amino acids 14 to 386 (373 residues), 573.1 bits, E=1.2e-176
• PF01546: Peptidase_M20
  • amino acids 75 to 387 (313 residues), 132.5 bits, E=2e-42
• PF07687: M20_dimer
  • amino acids 179 to 287 (109 residues), 74.3 bits, E=7.2e-25

Best Hits

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 100% identity to ccs:CCNA_03746)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

See A0A0H3CFT4 at UniProt or InterPro

Protein Sequence (391 amino acids)

>CCNA_03746 acetylornithine deacetylase (Caulobacter crescentus NA1000)
MVASSEALSARAIDILAKLVAFDTTSRRSNLALIEWVEQYLAELNVPTRRVPNADGTKSN
LMAMIGPAVEGGVVLSGHTDVVPVDGQPWSTDPWTLTERDGRLYGRGTCDMKGFLALALA
AAPDLAQANLRKPVHLAFSYDEEVGCLGAPDMIDVIAREVPRPALVVVGEPTDMVAVRAH
KGIASFKVTVTGREAHSSLTHLGVSANMVAIKLMAMLVGLSEKLEREADPNSPFTPKGAT
LTIGQVNGGTAVNILARECVFIFDLRTPAGMDPVALLSDFFAMASALDAQIKAKAPEGGV
KVERRSLTPAFAPEEDGVAEAFARKLAGDNGPARVVPYAAEAGQFQGAGFSTVICGPGSI
DQAHQPNEYVEISQMQRGGAFMRRLVEDLST