Protein Info for CCNA_03738 in Caulobacter crescentus NA1000

Annotation: hybrid histidine kinase/receiver domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details PF00512: HisKA" amino acids 216 to 281 (66 residues), 51.6 bits, see alignment E=1.2e-17 PF02518: HATPase_c" amino acids 328 to 439 (112 residues), 96.6 bits, see alignment E=1.8e-31 PF00072: Response_reg" amino acids 461 to 573 (113 residues), 89.8 bits, see alignment E=2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3623)

Predicted SEED Role

"FIG00482085: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCZ6 at UniProt or InterPro

Protein Sequence (595 amino acids)

>CCNA_03738 hybrid histidine kinase/receiver domain protein (Caulobacter crescentus NA1000)
MGGGGAPMSAETKDIDLERAVASRRVNTYLRLSSTFAICATLHLVVGLRWVWIWGALYTA
IQFLETWLALQLIKRPQSSPDRWRRFSVIALPFLTSAVFGFLAIPLFASDARFAPTLGGM
LLAGALMNVVIVHGGLRSATIAAATPYVGYLLVIPIVARQANPDAPLANALWFGALLLIA
AVAVASRTLHAALKAEADAKTEAERRRHEAEEAVAAKSAFVAMISHELRTPISAILAGAG
RLHSEAPEASSKVHAQLIADAGGLMRTLLNDLLDFSRLEAGRMSVEKSPFNLRQSLSDTL
RFWRPELARKGLKLRVVGASTIPQWTLGDAMRLKQVLNNLLSNAAKFTRSGGVSVTLRAE
IVGDQVRLVVDVVDTGPGIPEAALPRLFTPFDQLNESVARLHGGSGLGLAISRELARLMG
GDLTASNALGQGAHFRFSALLEAAEAPVVPTLGPSISGLRVLVVDDHVVNRRAVELVLQP
FGVEATLAESGEEALELLRSEVFDAILMDVYMPGMDGRETTRTLRAGQGPNRDAPVVAVT
ASATIKDWEACAAAGMNAHVAKPIDPAELFSALAQVMAARDAVGPFRTDVAASSA