Protein Info for CCNA_03735 in Caulobacter crescentus NA1000

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00456: Transketolase_N
  • amino acids 7 to 327 (321 residues), 411.8 bits, E=4.8e-127
• TIGR00232: transketolase
  • amino acids 7 to 650 (644 residues), 779.6 bits, E=1.2e-238
• PF13292: DXP_synthase_N
  • amino acids 8 to 189 (182 residues), 25.6 bits, E=1.8e-09
• PF02775: TPP_enzyme_C
  • amino acids 112 to 239 (128 residues), 22.8 bits, E=1.7e-08
• PF02779: Transket_pyr
  • amino acids 349 to 518 (170 residues), 186.7 bits, E=7.7e-59
• PF02780: Transketolase_C
  • amino acids 542 to 647 (106 residues), 38.7 bits, E=2.2e-13

Best Hits

Swiss-Prot: 58% identical to TKT1_XANFL: Transketolase 1 (tkt) from Xanthobacter flavus

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 100% identity to ccs:CCNA_03735)

Predicted SEED Role

"Transketolase (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (7/8 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• Bifidobacterium shunt (11/15 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• oxygenic photosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of ansamycins
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

See A0A0H3CFS6 at UniProt or InterPro

Protein Sequence (653 amino acids)

>CCNA_03735 transketolase (Caulobacter crescentus NA1000)
MPVSPIKMADAIRVLSMDAVHKAKSGHQGMPMGMADVATVLWGKFLKFDASKPDWADRDR
FVLSAGHGSMLLYSLLHLTGFKAMTMKEIENFRQWGALTPGHPEVHHTPGVETTTGPLGQ
GLATAVGMAMAEAHLAARYGSDLVDHRTWVIAGDGCLMEGVSHEAISIAGRLKLSKLTVL
FDDNNTTIDGVATIAETGDQVARFKAAGWAVKVVDGHDHGKIAAALRWATKQDRPTMIAC
KTLISKGAGPKEGDPHSHGYTLFDNEIAASRVAMGWDAAPFTVPDDIAKAWKSVGRRGAK
VRKAWEAKLAASPKGADFTRAMKGELPANAFEALDAHIAKALETKPVNATRVHSGSALEH
LIPAIPEMIGGSADLTGSNNTLVKGMGAFDAPGYEGRYVHYGVREFGMAAAMNGMALHGG
IIPYSGTFLAFADYSRAAIRLGALMEARVVHVMTHDSIGLGEDGPTHQPVEHVASLRAIP
NLLVFRPADAVEAAECWKAALQHQRTPSVMTLSRQKTPHVRTQGGDLSAKGAYELLAAEG
GEAQVTIFASGTEVGVAVAARDILQAKGKPTRVVSTPCWELFDQQPAAYQAAVIGKAPVR
VAVEAGVKMGWERFIGENGKFIGMKGFGASAPFERLYKEFGITAEAVAEAALA