Protein Info for CCNA_03732 in Caulobacter crescentus NA1000

Annotation: N-acyl-D-glucosamine 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 48% identical to MANA_RHIME: Mannose-6-phosphate isomerase (pmi) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01809, mannose-6-phosphate isomerase [EC: 5.3.1.8] (inferred from 100% identity to ccr:CC_3617)

Predicted SEED Role

"Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.3.1.8)

MetaCyc Pathways

colanic acid building blocks biosynthesis (10/11 steps found)
D-mannose degradation II (2/2 steps found)
GDP-mannose biosynthesis (3/4 steps found)
mannitol degradation II (3/4 steps found)
β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
D-mannose degradation I (1/2 steps found)
1,5-anhydrofructose degradation (3/5 steps found)
superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
mannitol biosynthesis (1/3 steps found)
β-(1,4)-mannan degradation (2/7 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.8

Use Curated BLAST to search for 5.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCZ1 at UniProt or InterPro

Protein Sequence (386 amino acids)

>CCNA_03732 N-acyl-D-glucosamine 2-epimerase (Caulobacter crescentus NA1000)
MTNAFADAARLRDRLKTWAVEAAYPIWWEVGADRVKGGFFEKIDLDGQAVDGPRRGRVLP
RQIYAYAIAGDLGWRGPWRAAVEHGLAYFLSAYRRSDGQFRTLVGPNGESLDDTADLYDQ
AFALFALAAVAKALPDRADDARTLALVVRERLIAERKHPVAGFHQTNPPSAPLQSNPHMH
LFEAMLAWNEIDKDPIWRTLADEIAELALSRFIHAPSGQIREFFDLDWNPAPGVAGRICE
PGHQFEWGWLLMRWGQLAGRADATAAALRMIDDAETHGVDLSRGVAINALLDDFSTHDDG
ARLWPQTERIKAAVLAAEITGQARYWDMAAAAAEGLMAYLRTAIPGLWRDKYQPDETFIE
EPVPASSFYHIALAILEMDRVINAAS