Protein Info for CCNA_03731 in Caulobacter crescentus NA1000

Annotation: histidinol phosphatase-family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 TIGR01662: HAD hydrolase, family IIIA" amino acids 11 to 160 (150 residues), 110.6 bits, see alignment E=9.8e-36 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 11 to 158 (148 residues), 120.8 bits, see alignment E=6.8e-39 PF00702: Hydrolase" amino acids 38 to 154 (117 residues), 33.7 bits, see alignment E=7.3e-12 PF13419: HAD_2" amino acids 112 to 155 (44 residues), 31.5 bits, see alignment E=2.8e-11 PF13242: Hydrolase_like" amino acids 116 to 165 (50 residues), 46.2 bits, see alignment E=5.4e-16

Best Hits

Swiss-Prot: 42% identical to GMHBB_RHOPA: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 100% identity to ccs:CCNA_03731)

MetaCyc: 37% identical to D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase (Aneurinibacillus thermoaerophilus)
RXN-11365 [EC: 3.1.3.83]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.- or 3.1.3.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCB7 at UniProt or InterPro

Protein Sequence (181 amino acids)

>CCNA_03731 histidinol phosphatase-family protein (Caulobacter crescentus NA1000)
MTSPPAPPPLKAVFLDRDGVLNIDHGYVHDPAKLDWIEGARDAVAAMTRAGLKVLVVTNQ
SGIGRGYFDEPALERFHAAMQGQLAQVGGRIDAFYHCPFHETAAVEAYRVADHPDRKPNP
GMILRGLAEWGLRPDEAVIIGDRDIDVEAGRRAGMPGYLFAGGSLRAFVGAVLGDRVPAL
K