Protein Info for CCNA_03712 in Caulobacter crescentus NA1000

Annotation: ExoD-family ABC transport membrane permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 122 to 159 (38 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details PF06055: ExoD" amino acids 8 to 183 (176 residues), 166.5 bits, see alignment E=2.1e-53

Best Hits

Swiss-Prot: 30% identical to Y1875_SYNY3: Uncharacterized protein slr1875 (slr1875) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_3598)

Predicted SEED Role

"exopolysaccharide synthesis protein ExoD-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CFQ8 at UniProt or InterPro

Protein Sequence (204 amino acids)

>CCNA_03712 ExoD-family ABC transport membrane permease (Caulobacter crescentus NA1000)
MMSEKSLADVIEGFGEDASPTLTVGQMLAAFDSRAFGAMLLVFGLLNTLPLPPGSSTILS
LPILLLAPQIAMGADTPWLPRGLIEKPLKRDDLRGLFRRLGPIVRSMELITRPRLRPLFA
PLGERMVGVVCTLLALVLVLPIPLGNLAPGATVAVLALALLQRDGILALLGYLMAVGSGA
LLFVSAHVVVMGARKLFGVFSGLF