Protein Info for CCNA_03702 in Caulobacter crescentus NA1000

Annotation: SSU ribosomal protein S1P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 TIGR00717: ribosomal protein bS1" amino acids 13 to 531 (519 residues), 641.7 bits, see alignment E=4.1e-197 PF00575: S1" amino acids 27 to 96 (70 residues), 34.4 bits, see alignment E=4.8e-12 amino acids 116 to 181 (66 residues), 41.5 bits, see alignment E=2.9e-14 amino acids 199 to 270 (72 residues), 77.7 bits, see alignment E=1.4e-25 amino acids 284 to 357 (74 residues), 70.8 bits, see alignment E=2e-23 amino acids 371 to 444 (74 residues), 71.7 bits, see alignment E=1.1e-23 amino acids 457 to 531 (75 residues), 62.9 bits, see alignment E=6.2e-21

Best Hits

Swiss-Prot: 68% identical to RS1_RHOPA: 30S ribosomal protein S1 (rpsA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 100% identity to ccs:CCNA_03702)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCW5 at UniProt or InterPro

Protein Sequence (569 amino acids)

>CCNA_03702 SSU ribosomal protein S1P (Caulobacter crescentus NA1000)
MADDMSFNPTRDDFEALLNDSMGGRDFAEGTVVKGKVVGIEKDFAIIDVGLKTEGRVQLK
EFGVDENGKATVKAGDTVEVFLERLENAMGEAVISREKAKREEAWTRLEGVYARNEPVMG
AIVGRVKGGFTVDLGGASAFLPGSQVDIRPVRDVGPLMGKEQPFAILKMDRPRGNIVVSR
RAILEEARAEQRTELVSQLQEGEIREGVVKNITDYGAFVDLGGIDGLLHVTDMSWKRVNH
PSQVLAVGDTVKVQIVKINPDTQRISLGMKQLQSDPWDGVEAKYPVGAKFTGRITNITDY
GAFVELEAGVEGLVHVSEMSWTKKNVHPGKIVSTSQEVDVVVLDVDPSKRRVSLGLKQAL
ANPWEAFLEAHPVGSTVEGEVKNATEFGLFVGLDNDIDGMVHLSDIDWSVPGEEAMARYK
KGDMVKAKVLDVDVEKERISLGIKQLAGDPMSGDTYRKNQTVTVTVTEVTSGGIEVRFGE
DDAPMTAFIRKSDLSRDRQEQRPERFAVGDRVDAQITNVDKAARRVSLSIKSLEMAEEKE
AIEQFGSSDSGASLGDILGAALRERASKD