Protein Info for CCNA_03667 in Caulobacter crescentus NA1000

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07027: DUF1318" amino acids 29 to 118 (90 residues), 89.8 bits, see alignment E=7e-30

Best Hits

KEGG orthology group: K09978, hypothetical protein (inferred from 100% identity to ccs:CCNA_03667)

Predicted SEED Role

"Putative uncharacterized protein ydbL, may be related to amine metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDZ2 at UniProt or InterPro

Protein Sequence (118 amino acids)

>CCNA_03667 hypothetical protein (Caulobacter crescentus NA1000)
MIRKTMTVLALGLAMSAAGAGLAMAQSAAAKATVDAAKTAGTVGEQADGYLGIVSGGDAA
LRAAVTEINTGRAAAYKDIAAKTGATPEAAGQATAKQLYARLAPGQYWKPLDGGWIKK