Protein Info for CCNA_03653 in Caulobacter crescentus NA1000

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 3 to 103 (101 residues), 117.5 bits, E=4.9e-38
• TIGR01068: thioredoxin
  • amino acids 7 to 104 (98 residues), 123.6 bits, E=1.6e-40
• PF00578: AhpC-TSA
  • amino acids 14 to 63 (50 residues), 27.4 bits, E=5.8e-10
• PF13098: Thioredoxin_2
  • amino acids 17 to 102 (86 residues), 42.5 bits, E=1.4e-14
• PF13905: Thioredoxin_8
  • amino acids 20 to 60 (41 residues), 30.4 bits, E=8.2e-11

Best Hits

Swiss-Prot: 63% identical to THIO_RHORU: Thioredoxin (trxA) from Rhodospirillum rubrum

KEGG orthology group: K03671, thioredoxin 1 (inferred from 100% identity to ccr:CC_3539)

MetaCyc: 49% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"FIG149041: Thioredoxin"

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (3/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See A0A0H3CDN9 at UniProt or InterPro

Protein Sequence (110 amino acids)

>CCNA_03653 thioredoxin (Caulobacter crescentus NA1000)
MSTVAVTDATFEADVLKSSKPVLVDFWAEWCGPCKQIAPALEQLSEELADVVTIAKVNIE
DSPTTPSRYGVRGIPTMMLFRDGQMTSMKVGAMPKQKILEWLNEAGVQAA