Protein Info for CCNA_03648 in Caulobacter crescentus NA1000

Annotation: YjeE family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE" amino acids 6 to 137 (132 residues), 101.6 bits, see alignment E=1.6e-33 PF02367: TsaE" amino acids 7 to 132 (126 residues), 131.3 bits, see alignment E=1.1e-42

Best Hits

Swiss-Prot: 38% identical to TSAE_RICBR: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 100% identity to ccs:CCNA_03648)

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDN3 at UniProt or InterPro

Protein Sequence (148 amino acids)

>CCNA_03648 YjeE family ATPase (Caulobacter crescentus NA1000)
MKTLSLADEAATQALGRTLAGALRPGDALCLTGPLGAGKSTLARALIRALTTPDEEVPSP
TFTLVQFYETPAFPLAHFDLYRLSDPDEAYEIGLDEALDDGVALIEWPQRLEGRLPRTRL
DIDIALDGDARRAVIVAHGDFEGRDLEF