Protein Info for CCNA_03647 in Caulobacter crescentus NA1000

Annotation: lysophospholipid acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF19576: Acyltransf_2" amino acids 45 to 260 (216 residues), 40.9 bits, see alignment E=1.2e-14 PF01553: Acyltransferase" amino acids 80 to 214 (135 residues), 58.1 bits, see alignment E=8.5e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03647)

Predicted SEED Role

"acyltransferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCR3 at UniProt or InterPro

Protein Sequence (291 amino acids)

>CCNA_03647 lysophospholipid acyltransferases (Caulobacter crescentus NA1000)
MVHVPAAGAVQAGQAADPHIIDTLIAERAPRLTGSPLWPLVKPGLYRLLDYRKARAMAET
IETMGGQAALDHVSRLLSLKVDIRGLEHLPAEGRVVIVANHPTGIGDGVAVYDALKTHRP
DIVFYANADAHRVCPRFDDVLIPVEWVEEKRSRERMRLTLSMTREAMEAERALMIFPAGR
LAVTDAEGRLSDPPWMSSAVSIARKYGAPIAPIHLEGPWSTLFHLFGRLSRELRDITLFH
ELLNKTGRRFSLTIGPPVDPEALPRDAEQATEVLKRYVERQLPNEPTSPLT