Protein Info for CCNA_03645 in Caulobacter crescentus NA1000

Annotation: nucleotide-sugar pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 9 to 188 (180 residues), 146.3 bits, E=4.1e-47
• PF00293: NUDIX
  • amino acids 49 to 181 (133 residues), 25 bits, E=8.3e-10

Best Hits

Swiss-Prot: 56% identical to NUDK_KLEP7: GDP-mannose pyrophosphatase NudK (nudK) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_03645)

MetaCyc: 52% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"GDP-mannose pyrophosphatase YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

See A0A0H3CFI3 at UniProt or InterPro

Protein Sequence (195 amino acids)

>CCNA_03645 nucleotide-sugar pyrophosphatase (Caulobacter crescentus NA1000)
MSVKDRVRVRETRLLSDNWYVLRTTTFDWKRRDGTWQTQSREHYDRGNGAVLLPYNIENR
TVLLVKQFRYPAFVNGCDDLLIEAAAGLLDDAEPEVRIRAEVEEELGYRLGEVRKVFEAF
MSPGSVTEILHFFVAEYDAAMRISDGGGHPDEGEDIEVLEMTMEQALAMIADGRIRDAKT
IMLLQHLALTVLRTA