Protein Info for CCNA_03644 in Caulobacter crescentus NA1000

Annotation: succinate dehydrogenase cytochrome B-556 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 30 to 54 (25 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details PF01127: Sdh_cyt" amino acids 9 to 124 (116 residues), 101.1 bits, see alignment E=2.3e-33 TIGR02970: succinate dehydrogenase, cytochrome b556 subunit" amino acids 10 to 128 (119 residues), 87.5 bits, see alignment E=4e-29

Best Hits

KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 100% identity to ccs:CCNA_03644)

Predicted SEED Role

"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDW7 at UniProt or InterPro

Protein Sequence (135 amino acids)

>CCNA_03644 succinate dehydrogenase cytochrome B-556 subunit (Caulobacter crescentus NA1000)
MTDTSRGLPERPMSPHLQVWRWHITMACSILHRGCVVGLWVGAVILAGWAAALAAGPDAY
ASYVGLLGSPIGKLVLLGETFAVFFNVAYTIRQTFWDAGKGFAPRTADMTGAMAIAFAVV
ATIVTWVIAGGIGAF