Protein Info for CCNA_03643 in Caulobacter crescentus NA1000

Annotation: succinate dehydrogenase membrane anchor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details PF01127: Sdh_cyt" amino acids 24 to 132 (109 residues), 63.4 bits, see alignment E=1.1e-21 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 38 to 140 (103 residues), 63.4 bits, see alignment E=9.8e-22

Best Hits

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 100% identity to ccs:CCNA_03643)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CDM8 at UniProt or InterPro

Protein Sequence (151 amino acids)

>CCNA_03643 succinate dehydrogenase membrane anchor subunit (Caulobacter crescentus NA1000)
MGHRRRHRSVLIMSKKDLFQPQQFRTPLSRARGMGASRHGVSHFITERVSGLALAPLTVW
GAYAALKQVRAPHDVVVQWMAQPVNAVLLSLLLIAALVHLQSAVQVVIEDYIERFTTKTA
LVIGNLFVCVLAGAVGVFSILKVALTVTGAH