Protein Info for CCNA_03641 in Caulobacter crescentus NA1000

Annotation: succinate dehydrogenase iron-sulfur protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13085: Fer2_3
  • amino acids 29 to 133 (105 residues), 116.3 bits, E=1.3e-37
• TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein
  • amino acids 32 to 252 (221 residues), 272.9 bits, E=8.7e-86
• PF13183: Fer4_8
  • amino acids 168 to 242 (75 residues), 41.1 bits, E=4.3e-14
• PF13237: Fer4_10
  • amino acids 170 to 239 (70 residues), 36.2 bits, E=9.9e-13
• PF13534: Fer4_17
  • amino acids 170 to 243 (74 residues), 42.2 bits, E=1.8e-14

Best Hits

Swiss-Prot: 73% identical to SDHB_PARDE: Succinate dehydrogenase iron-sulfur subunit (sdhB) from Paracoccus denitrificans

KEGG orthology group: K00240, succinate dehydrogenase iron-sulfur protein [EC: 1.3.99.1] (inferred from 100% identity to ccr:CC_3526)

MetaCyc: 62% identical to complex II subunit 2 (Arabidopsis thaliana col)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]; 1.3.5.1 [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• methylaspartate cycle (15/19 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (2/2 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• succinate to cytochrome bo quinol oxidase (cyanobacteria, cytoplamic membrane) (1/2 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• mixed acid fermentation (9/16 steps found)
• reductive TCA cycle II (6/12 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (18/56 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

See A0A0H3CC40 at UniProt or InterPro

Protein Sequence (260 amino acids)

>CCNA_03641 succinate dehydrogenase iron-sulfur protein (Caulobacter crescentus NA1000)
MVELALPKNSQVKSGKHWPAPAGAKKVKTFKIYRYDPESGGNPRWDTYDVDVDAVGPMVL
DALLYIKNTIDPTLAFRRSCREGVCGSCSMNIGGRNTLACTHGWAEVPGKAVQISPLPHM
PVVKDLIPDLTLFYAQYASIEPWLHTDTPEPQTEWKQSPEDREKLDGLYECILCACCSTS
CPSYWWNGDKYLGPAALLHAYRWLIDSRDEATGDRLDALEDPFKLYRCHTIMNCAQVCPK
GLNPAKAIAEIKKMMVERVV