Protein Info for CCNA_03626 in Caulobacter crescentus NA1000

Updated annotation (from data): ATP phosphoribosyltransferase (EC 2.4.2.17)
Rationale: Important for fitness in many defined media, and cofit with histidinol dehydrogenase (CCNA_02431). Hits TIGR00070.
Original annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR00070: ATP phosphoribosyltransferase" amino acids 7 to 208 (202 residues), 161.9 bits, see alignment E=7.8e-52 PF01634: HisG" amino acids 56 to 222 (167 residues), 120.3 bits, see alignment E=3.8e-39

Best Hits

Swiss-Prot: 100% identical to HIS1_CAUVC: ATP phosphoribosyltransferase (hisG) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to ccs:CCNA_03626)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.17

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H5P6 at UniProt or InterPro

Protein Sequence (320 amino acids)

>CCNA_03626 ATP phosphoribosyltransferase (EC 2.4.2.17) (Caulobacter crescentus NA1000)
MSTPMIFAIPSKGRLKDQVEAWLADCGFKLEMTGGARGYSAELSGLPGVSVRLLSAGDIA
AGLDSGDLHLGVTGEDLLRERGDDMDSRVMLLRALGFGRADLVVTAPKNWLDVDTMADVD
EVGHAHLARTGRRLRVATKYVTQTRAFFARHGVADYRIVESSGATEGAPAAGAAELVVDI
TTTGATLAANGLKILSDGVILKSQAQLTASLTAGWNGEQLDALRRLLSVVEAKGRAGKLA
TLVWPAEQDRAAQDAVAAFIARGGSRRANGALLATADLFDAAAALAEAGVEPVTVSRPDY
VFESRSAVLDRFAEALKSKI