Protein Info for CCNA_03594 in Caulobacter crescentus NA1000

Annotation: SIR2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 12 to 186 (175 residues), 145.2 bits, E=1.1e-46

Best Hits

Swiss-Prot: 100% identical to NPD_CAUVC: NAD-dependent protein deacylase (cobB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 100% identity to ccs:CCNA_03594)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Sequence Analysis Tools

See A0A0H3CDS5 at UniProt or InterPro

Protein Sequence (238 amino acids)

>CCNA_03594 SIR2 family protein (Caulobacter crescentus NA1000)
MRGIMKVFVLTGAGVSAESGLGTFRDKDGVWTKYDLNEVATPQGFARNPALVRDFYNARR
ANLAGARPNAAHDALAQLEAGLARRGGELFLCTQNVDDLHEKAGCRRVIHMHGELAVTRC
HHCEATWPDTGPLKPDTVCAACARDGGARPHVVWFGEIPLFMDQIEDALSAADLFVSIGT
SGSVYPAAGFVAEARAMGIATCEINLEPSANAYVFDEKVYGPATEVVPAWVERLLARL